PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30170.m014124
Common NameLOC8275808, RCOM_1596220
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family SRS
Protein Properties Length: 311aa    MW: 34744.2 Da    PI: 8.1464
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30170.m014124genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702225.21.3e-69892454153
         DUF702   4 gtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasa..........aeaaskrkrelkskkqsalsst 89 
                    g+++CqdCGnqakkdCah RCRtCCksrgf C+thvkstWvpaakrrerqqql+a+++++++++          + +++kr+re+ +    +l++t
  30170.m014124  89 GGMNCQDCGNQAKKDCAHLRCRTCCKSRGFLCQTHVKSTWVPAAKRRERQQQLSALQQQQQQHQhqqnqeqnqfRGENPKRQREN-QGGVPSLACT 183
                    789***************************************************9999888877454444333222233333332.3334455555 PP

         DUF702  90 klssaeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGle 153
                    +   a++++ le+s++P+ev+s+avfrcvrvs ++d +e++aYqtav+igGhvfkGiLydqG++
  30170.m014124 184 R--LATTTSGLEVSHFPPEVNSPAVFRCVRVSPMEDTDEQYAYQTAVNIGGHVFKGILYDQGVD 245
                    5..5555677999*************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051423.0E-6790245IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016232.0E-2692134IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016248.2E-27196244IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048467Biological Processgynoecium development
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MAGWFYLSKQ EEEKDQENNN NNLFLYRSSN EQEIYNNNNK GFEIWPQYYH QQQNMNSYSS  60
FGVGPSRRSF SDESSRSGFT VMRQSGLGGG MNCQDCGNQA KKDCAHLRCR TCCKSRGFLC  120
QTHVKSTWVP AAKRRERQQQ LSALQQQQQQ HQHQQNQEQN QFRGENPKRQ RENQGGVPSL  180
ACTRLATTTS GLEVSHFPPE VNSPAVFRCV RVSPMEDTDE QYAYQTAVNI GGHVFKGILY  240
DQGVDVRYTS GGESSSGGAQ QLNLITAAAT TATLTATANP THPGALLDPS LYPASFNAYI  300
AGTQFFPPPR S
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0119661e-149AP011966.1 Jatropha curcas DNA, clone: JHL18I08, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002510471.10.0PREDICTED: protein SHI RELATED SEQUENCE 5 isoform X1
SwissprotQ9LQZ51e-93SRS5_ARATH; Protein SHI RELATED SEQUENCE 5
TrEMBLB9R8280.0B9R828_RICCO; Transcription factor, putative
STRINGPOPTR_0002s03000.11e-131(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF88234125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75520.11e-78SHI-related sequence 5